PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004507522.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MYB
Protein Properties Length: 710aa    MW: 79994.9 Da    PI: 4.6903
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004507522.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.3e-1777124148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT  Ed +lv++v+++G g+W+++ + +g+ R++k+c++rw+++l
   XP_004507522.1  77 KGPWTLAEDAILVEYVQKYGEGNWSAVQKIFGLARCGKSCRLRWNNHL 124
                      79********************************************97 PP

2Myb_DNA-binding47.83.2e-15131173246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       ++T+eE+  +v+++  lG++ W+ Ia++++ gRt++++k++w++
   XP_004507522.1 131 CAFTAEEENSIVELHSILGNK-WAQIAQKLP-GRTDNEIKNYWHT 173
                      589******************.*********.***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.99472128IPR017930Myb domain
SuperFamilySSF466891.98E-3075171IPR009057Homeodomain-like
SMARTSM007171.7E-1476126IPR001005SANT/Myb domain
PfamPF002499.4E-1677124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2278132IPR009057Homeodomain-like
CDDcd001672.18E-1279124No hitNo description
PROSITE profilePS5129419.278129179IPR017930Myb domain
SMARTSM007172.1E-13129177IPR001005SANT/Myb domain
PfamPF002491.8E-13131173IPR001005SANT/Myb domain
CDDcd001671.40E-10132173No hitNo description
Gene3DG3DSA:1.10.10.609.0E-21133177IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 710 aa     Download sequence    Send to blast
MSSIPNTDDG QKIVKRIRYD RETVKHSQSL VSQEEADNGD NTEEGGNIEE GRGDGSLKKG  60
PDNRDTKEGG RDGNLTKGPW TLAEDAILVE YVQKYGEGNW SAVQKIFGLA RCGKSCRLRW  120
NNHLRPDLRK CAFTAEEENS IVELHSILGN KWAQIAQKLP GRTDNEIKNY WHTRSKRLKK  180
VGLPIYPEEV EQRAKKINQE HVDLIANQHC DDDSQTTNLN ILDEIFESYI RHPGPILLPP  240
SVDIHGSDLV DRSIDFNSNN VVVPQIDQRK NYSMVSPPCD PCTSNQLHDN YIMLFPPCDS  300
CTNNQFHGLS CDLCTNNQFH DNYFMLSPPC DPCTSNQFHG PPCDPCISNQ CHGPPSDACT  360
SNQFHDNYFM LSPPCDSCTN NKFHGPPCDP CTINQFHEYD NYSMLSPLCD SCTNNQFHGP  420
PCDPCTNNQF HGPPCDPCTN NQFHEYNNLT IDSHATLNDN ISSSEPIYDE STTYELPSFQ  480
CLHTQKCNLN TPVSRIPPHE SIDTVIQIPP IEEPKKSIIV YSDNDGLLNA RAFQNGSNVQ  540
DGIEQTAHDA TFKGSNVQEG IEQTAHDEAL KISTYNSICA EWDKLDELKY NPFNESFATF  600
QCSDHNNHHT SIWPIDEIQS LETTQNHRSN NSHITNDSSI LNQIDLGHLD ALPDFNQPNN  660
IDYSSDHNGI NQNAFMARTN NFSMIGYLNQ TDLTCSDVLP DSNIIPRKNE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31741774106B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004507522.10.0PREDICTED: myb-like protein M
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26960.17e-55myb domain protein 81